PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10013616m
Common NameCICLE_v10013616mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 304aa    MW: 33872.2 Da    PI: 4.5468
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10013616mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1017.1e-32117173258
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                      dDgy+WrKYGqK++k+s++prsYY+Ct ++C++kk+vers +dp++++itYeg H h
  Ciclev10013616m 117 DDGYKWRKYGQKSIKNSPNPRSYYKCTNPRCSAKKQVERSCDDPDTLIITYEGLHLH 173
                      8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081127.141111176IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.6E-29112173IPR003657WRKY domain
SuperFamilySSF1182901.44E-26113173IPR003657WRKY domain
SMARTSM007747.6E-35116175IPR003657WRKY domain
PfamPF031062.4E-25117173IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MEKENDSWFE DDELVRELLD DETPFFVLPE EPTDEANRYS SPSNNEDQAT LKMVTSSTVY  60
SGPTIEDIDN ALSVAAGQEQ YSQAISKARI SLFEGGLGKI ENKYTLKIKS WANGMADDGY  120
KWRKYGQKSI KNSPNPRSYY KCTNPRCSAK KQVERSCDDP DTLIITYEGL HLHFAYPYFI  180
LNQPQPQASP TTTKRKRTNP QAEETKEQIL DMQQNSSPSS FSNNNTECPS ASEAMSPQGL  240
LEDVVPLMIR NPTGNNSNNN NNVSSNTSSC SSYRSPPTSP SSLSWSPNYS LSCFDMGINT  300
IIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-201151731674Probable WRKY transcription factor 4
2lex_A6e-201151731674Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8276104e-45KT827610.1 Manihot esculenta WRKY transcription factor 35 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006429119.10.0hypothetical protein CICLE_v10013616mg
TrEMBLV4US320.0V4US32_9R
STRINGGLYMA07G16040.21e-104(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94052637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.12e-53WRKY DNA-binding protein 49